CPA6 Antibody - middle region : FITC

CPA6 Antibody - middle region : FITC
Artikelnummer
AVIARP57397_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the family of carboxypeptidases, which catalyze the release of C-terminal amino acid, and have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Polymorphic variants and a reciprocal translocation t(6;8)(q26;q13) involving this gene, have been associated with Duane retraction syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPA6

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carboxypeptidase A6

Protein Size: 437

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57397_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57397_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57094
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×