CPEB3 Antibody - middle region : Biotin

CPEB3 Antibody - middle region : Biotin
Artikelnummer
AVIARP55103_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of CPEB3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPEB3

Key Reference: Heilig,R., (2006) Science 313 (5794), 1788-1792

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytoplasmic polyadenylation element-binding protein 3

Protein Size: 698

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55103_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55103_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22849
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×