Cpne7 Antibody - C-terminal region : FITC

Cpne7 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55052_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of Cpne7 remains unknow.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copine VII (Predicted), isoform CRA_b EMBL EDL92784.1

Protein Size: 486

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55052_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55052_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361433
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×