CPXM1 Antibody - middle region : Biotin

CPXM1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57346_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene likely encodes a member of the carboxypeptidase family of proteins. Cloning of a comparable locus in mouse indicates that the encoded protein contains a discoidin domain and a carboxypeptidase domain, but the protein appears to lack residues necessary for carboxypeptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPXM1

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable carboxypeptidase X1

Protein Size: 734

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57346_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57346_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56265
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×