CRAMP (140-173) (mouse) (trifluoroacetate salt)

CRAMP (140-173) (mouse) (trifluoroacetate salt)
Artikelnummer
CAY37502-10
Verpackungseinheit
10 mg
Hersteller
Cayman Chemical

Verfügbarkeit: wird geladen...
Preis wird geladen...
Shelf life (days): 1460.0

Formulation: A solid

Amino Acids: GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH

Purity: ≥95%

Formula Markup: C178H302N50O46 / XCF3COOH

Formula Weight: 3878.7

Notes: Cathelicidin-related antimicrobial peptide (CRAMP) (140-173) is a 34-amino acid peptide derivative of the 38-amino acid antimicrobial peptide CRAMP.{68335,68336} Mature CRAMP is formed from cleavage of the full-length peptide by cathepsin G.{68337,68338} CRAMP (140-173) (1 µg/ml) is active against K. pneumoniae in vitro.{68335} It decreases neutrophil infiltration of colonic epithelial and luminal surfaces in a porcine model of colitis when administered at a dose of 10 mg/kg.{68339} Ileal administration of CRAMP (140-173) (10 mg/kg) decreases disease severity and cecal bacterial burden and increases survival in a mouse model of C. difficile infection.{68340} However, intra-articular administration of CRAMP (140-173) (10 µl of 25 µM) also increases disease severity and induces synovitis in a mouse model of surgery-induced osteoarthritis.{68341}
Mehr Informationen
Artikelnummer CAY37502-10
Hersteller Cayman Chemical
Hersteller Artikelnummer 37502-10
Verpackungseinheit 10 mg
Mengeneinheit STK
Methode Reinstoffe
Produktinformation (PDF) Download
MSDS (PDF) Download