CRAT Antibody - N-terminal region : Biotin

CRAT Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53559_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRAT

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carnitine O-acetyltransferase

Protein Size: 467

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53559_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53559_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1384
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×