CRBN Antibody - middle region : FITC

CRBN Antibody - middle region : FITC
Artikelnummer
AVIARP56883_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CRBN

Key Reference: N/A

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein cereblon

Protein Size: 442

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP56883_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56883_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51185
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×