CRISP1 Antibody - N-terminal region : FITC

CRISP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP53580_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine-rich secretory protein 1

Protein Size: 249

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53580_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53580_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 167
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×