CRTAC1 Antibody - N-terminal region : FITC

CRTAC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57101_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRTAC1

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cartilage acidic protein 1

Protein Size: 661

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57101_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57101_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55118
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×