CSNK2A2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Key Reference: Gottlieb,D.J., (er) BMC Med. Genet. 8 SUPPL 1, S9 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Casein kinase II subunit alpha'

Protein Size: 350

Purification: Affinity Purified

Subunit: alpha'

• Artikelnummer: AVIARP53595_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53595_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1459
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin