CSNK2A2 Antibody - C-terminal region : Biotin

CSNK2A2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53596_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Key Reference: Gottlieb,D.J., (er) BMC Med. Genet. 8 SUPPL 1, S9 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Casein kinase II subunit alpha'

Protein Size: 350

Purification: Affinity Purified

Subunit: alpha'
Mehr Informationen
Artikelnummer AVIARP53596_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53596_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1459
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×