CSNK2A2 Antibody - C-terminal region : HRP

CSNK2A2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53595_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CSNK2A2

Key Reference: Gottlieb,D.J., (er) BMC Med. Genet. 8 SUPPL 1, S9 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Casein kinase II subunit alpha'

Protein Size: 350

Purification: Affinity Purified

Subunit: alpha'
Mehr Informationen
Artikelnummer AVIARP53595_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53595_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1459
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×