Cst6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of Cst6 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Cst6

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cystatin E/M EMBL AAH61036.1

Protein Size: 149

Purification: Affinity Purified

• Artikelnummer: AVIARP53533_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53533_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 73720
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin