CST9 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CST9

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cystatin-9

Protein Size: 159

Purification: Affinity Purified

• Artikelnummer: AVIARP59193_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59193_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 128822
• Wirt: Rabbit
• Konjugat: Conjugated, HRP