CUTC Antibody - middle region : Biotin

CUTC Antibody - middle region : Biotin
Artikelnummer
AVIARP56790_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CUTC

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: KLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Copper homeostasis protein cutC homolog

Protein Size: 273

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56790_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56790_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51076
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×