CXorf26 Antibody - middle region : HRP

CXorf26 Antibody - middle region : HRP
Artikelnummer
AVIARP56931_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CXorf26

Key Reference: Cheng,J., (2005) Science 308 (5725), 1149-1154

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0368 protein Cxorf26

Protein Size: 233

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56931_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56931_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51260
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×