CXorf67 Antibody - middle region : HRP

CXorf67 Antibody - middle region : HRP
Artikelnummer
AVIARP55962_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC340602

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: RRSLSGSADENPSCGTGSERLAFQSRSGSPDPEVPSRASPPVWHAVRMRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein CXorf67

Protein Size: 503

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55962_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55962_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 340602
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×