Cyb5r2 Antibody - C-terminal region : Biotin

Cyb5r2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP53714_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Cyb5r2 is responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-cytochrome b5 reductase 2

Protein Size: 276

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53714_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53714_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 365345
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×