Cyb5r2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Cyb5r2 is responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-cytochrome b5 reductase 2

Protein Size: 276

Purification: Affinity Purified

• Artikelnummer: AVIARP53714_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53714_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 365345
• Wirt: Rabbit
• Konjugat: Conjugated, FITC