CYB5RL Antibody - N-terminal region : HRP

CYB5RL Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56230_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC606495

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADH-cytochrome b5 reductase-like

Protein Size: 315

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56230_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56230_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 606495
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×