CYP20A1 Antibody - N-terminal region : HRP

CYP20A1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57758_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein lacks

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP20A1

Key Reference: Jiang,J.H., (2004) Ai Zheng 23 (6), 672-677

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome P450 20A1

Protein Size: 462

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57758_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57758_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57404
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×