CYP26B1 Antibody - N-terminal region : Biotin

CYP26B1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57351_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP26B1

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: LRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 26B1

Protein Size: 512

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57351_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57351_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56603
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×