CYP27C1 Antibody - middle region : Biotin

CYP27C1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54373_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP27C1

Key Reference: Nelson,D.R., (2004) Pharmacogenetics 14 (1), 1-18

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 27C1

Protein Size: 372

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54373_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54373_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 339761
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×