CYP4V2 Antibody - middle region : HRP

CYP4V2 Antibody - middle region : HRP
Artikelnummer
AVIARP55993_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CYP4V2 may have a role in fatty acid and steroid metabolism.This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4V2

Key Reference: Bezemer,I.D., (2008) JAMA 299 (11), 1306-1314

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome P450 4V2

Protein Size: 525

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55993_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55993_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285440
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×