CYP4X1 Antibody - middle region : FITC

CYP4X1 Antibody - middle region : FITC
Artikelnummer
AVIARP55763_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4X1

Key Reference: Savas,U., (2005) Arch. Biochem. Biophys. 436 (2), 377-385

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 4X1

Protein Size: 509

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55763_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55763_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 260293
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×