DAGLB Antibody - middle region : Biotin

DAGLB Antibody - middle region : Biotin
Artikelnummer
AVIARP55430_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAGLB

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sn1-specific diacylglycerol lipase beta

Protein Size: 672

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55430_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55430_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221955
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×