DAGLB Antibody - middle region : HRP

DAGLB Antibody - middle region : HRP
Artikelnummer
AVIARP55430_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAGLB

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 74kDa

Peptide Sequence: Synthetic peptide located within the following region: STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sn1-specific diacylglycerol lipase beta

Protein Size: 672

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55430_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55430_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221955
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×