DAPK1 Antibody - N-terminal region : Biotin

DAPK1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58219_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1

Molecular Weight: 157kDa

Peptide Sequence: Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Death-associated protein kinase 1

Protein Size: 1431

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58219_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58219_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1612
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×