DAPK1 Antibody - N-terminal region : HRP

DAPK1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58219_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1

Molecular Weight: 157kDa

Peptide Sequence: Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Death-associated protein kinase 1

Protein Size: 1431

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58219_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58219_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1612
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×