DAPP1 Antibody - middle region : FITC

DAPP1 Antibody - middle region : FITC
Artikelnummer
AVIARP55042_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAPP1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55042_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55042_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27071
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×