DBNDD2 Antibody - middle region : FITC

DBNDD2 Antibody - middle region : FITC
Artikelnummer
AVIARP56283_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DBNDD2 may modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DBNDD2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dysbindin domain-containing protein 2

Protein Size: 161

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56283_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56283_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55861
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×