DBNL Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function. DBNL acts as a k

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DBNL

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Drebrin-like protein

Protein Size: 430

Purification: Affinity Purified

• Artikelnummer: AVIARP54437_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54437_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Dog (Canine), Guinea Pig
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 28988
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin