DCUN1D4 Antibody - middle region : Biotin

DCUN1D4 Antibody - middle region : Biotin
Artikelnummer
AVIARP54513_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DCUN1D4

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DCN1-like protein 4

Protein Size: 292

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54513_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54513_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23142
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×