DCUN1D4 Antibody - N-terminal region : HRP

DCUN1D4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54512_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCUN1D4

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DCN1-like protein 4

Protein Size: 257

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54512_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54512_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23142
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×