DDHD2 Antibody - N-terminal region : FITC

DDHD2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55202_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDHD2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipase DDHD2

Protein Size: 711

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55202_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55202_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23259
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×