DDI1 Antibody - middle region : FITC

DDI1 Antibody - middle region : FITC
Artikelnummer
AVIARP56142_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDI1

Key Reference: Puente,X.S. (2004) Genome Res. 14 (4), 609-622

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein DDI1 homolog 1

Protein Size: 396

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56142_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56142_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 414301
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×