DENND1A Antibody - N-terminal region : HRP

DENND1A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57501_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1009

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57501_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57501_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57706
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×