DENND2C Antibody - middle region : Biotin

DENND2C Antibody - middle region : Biotin
Artikelnummer
AVIARP53471_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of DENND2C is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DENND2C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DENN domain-containing protein 2C

Protein Size: 871

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53471_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53471_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 163259
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×