DENND5A Antibody - N-terminal region : FITC

DENND5A Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55199_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DENND5A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: RYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DENN domain-containing protein 5A

Protein Size: 807

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55199_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55199_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23258
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×