DGKA Antibody - N-terminal region : HRP

DGKA Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53483_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important rol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DGKA

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Diacylglycerol kinase alpha

Protein Size: 735

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53483_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53483_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1606
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×