DHRS9 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. DHRS9 may play a role in the biosynthesis of retinoic acid from r

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHRS9

Key Reference: Jones,R.J., (2007) J. Biol. Chem. 282 (11), 8317-8324

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dehydrogenase/reductase SDR family member 9

Protein Size: 319

Purification: Affinity Purified

• Artikelnummer: AVIARP53475_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53475_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10170
• Wirt: Rabbit
• Konjugat: Conjugated, HRP