Dipk2a Antibody - N-terminal region : FITC

Dipk2a Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55633_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse 1190002N15Rik

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Deleted in autism protein 1 homolog

Protein Size: 444

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55633_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55633_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 68861
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×