DNAH6 Antibody - middle region : FITC

DNAH6 Antibody - middle region : FITC
Artikelnummer
AVIARP55679_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene belongs to the dynein family, whose members encode large proteins that are constituents of the microtubule-associated motor protein complex. This complex is composed of dynein heavy, intermediate and light chains, which can be axonemal or cytoplasmic. This protein is an axonemal dynein heavy chain. It is involved in producing force for ciliary beating by using energy from ATP hydrolysis. Mutations in this gene may cause primary ciliary dyskinesia (PCD) as well as heterotaxy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DYH6

Key Reference: N/A

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: QIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dynein heavy chain 6, axonemal

Protein Size: 408

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP55679_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55679_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1768
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×