Dnaja1 Antibody - N-terminal region : FITC

Dnaja1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54580_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Dnaja1 is a co-chaperone of Hsc70. Dnaja1 seems to play a role in protein import into mitochondria.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily A member 1

Protein Size: 397

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54580_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54580_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 15502
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×