DNAJA4 Antibody - C-terminal region : FITC

DNAJA4 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57276_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human DNAJA4

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: dnaJ homolog subfamily A member 4

Protein Size: 181

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57276_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57276_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55466
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×