DNAJB1 Antibody - N-terminal region : Biotin

DNAJB1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54795_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1

Key Reference: Cheng,X., (2008) J. Virol. 82 (3), 1229-1237

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily B member 1

Protein Size: 340

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54795_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54795_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 3337
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×