DNALI1 Antibody - N-terminal region : Biotin

DNALI1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53611_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNALI1

Key Reference: Combs,J., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (40), 14883-14888

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Axonemal dynein light intermediate polypeptide 1

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53611_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53611_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7802
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×