DOK6 Antibody - middle region : HRP

DOK6 Antibody - middle region : HRP
Artikelnummer
AVIARP55502_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DOK6 is a member of the DOK (see DOK1; MIM 602919) family of intracellular adaptors that play a role in the RET (MIM 164761) signaling cascade (Crowder et al., 2004 [PubMed 15286081]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DOK6

Molecular Weight: 38

Peptide Sequence: Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Docking protein 6

Protein Size: 331

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55502_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55502_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 220164
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×