DPY19L2 Antibody - middle region : HRP

DPY19L2 Antibody - middle region : HRP
Artikelnummer
AVIARP55709_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of DPY19L2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DPY19L2

Key Reference: Carson,A.R., (er) BMC Genomics 7, 45 (2006)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein dpy-19 homolog 2

Protein Size: 758

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55709_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55709_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283417
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×