DTWD1 Antibody - N-terminal region : FITC

DTWD1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57379_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DTWD1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: IPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DTW domain-containing protein 1

Protein Size: 304

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57379_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57379_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56986
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×